DPCstruct | MC45557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 139 ± 26 aa |
| Standard deviation of domain lengths | 25.67 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 64.59 |
| Pfam Score | 99.00 |
| Assigned Pfam label(s) | PF00223- PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2K6U8 | 1-139 | MYKTNWGIGHSLKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYLATDYGTQLSLFTHHMWI… |
| A0A2Z2C6A9 | 135-243 | IAGHMYRTNWGIGHGLKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYLAIDYGTQLSLFTH… |
| A0A5D2KKH8 | 200-312 | None |
| A0A5N6P8W7 | 152-275 | None |
| A0A7J9KJ29 | 73-246 | None |
| A0A2G3CMI3 | 3-169 | None |
| A0A1R3KZI6 | 115-268 | None |
| A0A3B6PKD4 | 221-353 | None |
| A0A6S7N825 | 2-175 | None |
| A0A2G2XBU1 | 215-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.