DPCstruct | MC45553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 334 |
|---|---|
| Mean domain length (aa) | 179 ± 46 aa |
| Standard deviation of domain lengths | 45.74 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.55 |
| Pfam Score | 98.26 |
| Assigned Pfam label(s) | CL0023- CL0104- PF00319- CL0262- CL0178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661FI72 | 2-170 | ELPLFPVSTVLFPGSTLSLRIFEPRYLELISHCMKTDSGFGVSLIKAGKEVGPAADCYTVGTLIKIIDWGQGKDGFLEIEIEGVCRF… |
| A0A7S1FX55 | 284-408 | IHFSGQVFYMPGRVNLGEQFGLFFFEPRYRLLIREVMAGQPEQNLRGHPLDVDSRRNFPEFIYVNQAPLRRGTMGVVVQVRRCRINY… |
| A0A7S2XLB9 | 53-372 | None |
| A0A534WAW2 | 14-142 | None |
| A0A7S2XKZ8 | 191-326 | None |
| A0A7S2U9U0 | 312-429 | None |
| A0A2H3D0N4 | 42-274 | None |
| A0A7N2L885 | 14-166 | None |
| A0A7S3ZLV1 | 232-336 | None |
| B6ACI0 | 113-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.