DPCstruct | MC45552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 219 ± 44 aa |
| Standard deviation of domain lengths | 44.44 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661F7M7 | 24-229 | ETIRSLVLGHLANYNNDPKKAFADGVTVYHKDGITPIKRVRLLQSKTTEEKLKGSKFGVRNSSGEIFKWMAYGNMHHVEIVQNRVTK… |
| A0A496KQJ1 | 1-133 | VRVDVFEKAGKYYLVPIYSWQVAKGILPDRAVVAYADEENWTIMDESFKFKFVLYANDLIKLTAKKNEFLGYFVSLNRATGAIDIRT… |
| A0A7K1UE75 | 50-289 | None |
| A0A5P0WUD1 | 3-197 | None |
| A0A136K613 | 7-181 | None |
| A0A2M8AIL8 | 1-145 | None |
| A0A139P5Q0 | 32-243 | None |
| A0A857DAM9 | 174-404 | None |
| A0A1X4N9Z9 | 790-956 | None |
| A0A356FV03 | 379-523 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.