DPCstruct | MC4555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 6.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18963 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0LR01 | 1-62 | MSATTWEIREFTLPRGTHRNDARELLTEYAEHGRWELARLCLYPDGRRRVWLRRKVIRVVRT |
| A0A7T9I9Z9 | 1-59 | MIEYEYRVMTFGRQVSREEARRALVEAAEHGDWELTRTRHYVGGARRSWLRRKMVRVPR |
| A0A2S8WSM8 | 15-74 | None |
| A0A3N4Z764 | 4-71 | None |
| A0A6J7S1M2 | 14-85 | None |
| A0A3N4GTB0 | 18-86 | None |
| A0A7X8B5F2 | 15-81 | None |
| A0A0K2R2W4 | 105-182 | None |
| G7GJE6 | 9-74 | None |
| Z9JWD0 | 26-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.