DPCstruct | MC45547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 217 ± 16 aa |
| Standard deviation of domain lengths | 15.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F2SJ57 | 2-197 | TDGLPIIPPTAERVAAMLQAVDRDPQEVLGQMAPKWAPATIQKVAINAVMAGCLPAYFPVVVTAVECVLEEAFNLYGVQATTNPIGP… |
| A0A354VH71 | 175-386 | ARRIEVGSLDDEFEFMFDQGFSDGLPVIPPTPERVVRMLTGTSRDPQEVVAVMPPNMGEVTVEKVAINCVMAGCKPEYLPVVIAAVE… |
| A0A7S3PLP2 | 7-235 | None |
| A0A7V4JIJ3 | 52-268 | None |
| A0A847DBW8 | 96-300 | None |
| A0A7J3BDJ6 | 115-331 | None |
| A0A7C1CYK0 | 262-482 | None |
| A0A538DGU3 | 82-288 | None |
| A0A537MM36 | 257-521 | None |
| A0A1V5C6Q8 | 78-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.