DPCstruct | MC45542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 277 ± 48 aa |
| Standard deviation of domain lengths | 48.21 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 31.62 |
| Pfam Score | 87.42 |
| Assigned Pfam label(s) | CL0004- PF10290 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L8VMK2 | 178-495 | SYVDVNKFKDITNNESCTCEVGDRVWFSGKNAPLADYLSVHFRGPLKLKQFAFYTSPGFTVNNSRSSSDWNRLAYYESSSKTADNVT… |
| H0GII3 | 11-343 | QSYQKLDFTNVGFTGSYVDVNKFKDITNNESCTCEVGDRVWFSGKNAPLADYLSVHFRGPLKLKQFAFYTSPGFTVNNSRSSSDWNR… |
| F7W9A9 | 107-274 | None |
| F7W9B1 | 115-306 | None |
| H2AXG7 | 22-344 | None |
| D0N3P2 | 185-486 | None |
| A0A024FZY8 | 376-681 | None |
| A0A371C004 | 202-445 | None |
| A0A376BAN5 | 16-290 | None |
| A0A0G2E011 | 135-403 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.