DPCstruct | MC4554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 10.52 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06923 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0F4E2 | 6-99 | AIGRRAGKLKAGTIILFAVDSQGKILAARKMQGVTVLAKFHPLPQYVNEDIHYMDHYHPLVQKENKLTQQAMENAREIYLRVELGNY… |
| A0A6J6EC59 | 1-91 | MAIGVGGRRYRGGRAFVALTAGEDDLVKDGMVLKGFTIFARSQRLTAYTGFSIDEIASGDRIALGEKRKVQEAAKSSAQHIVEHRDR… |
| A0A489FRG9 | 2-99 | None |
| A0A859FKJ6 | 20-103 | None |
| S7JT52 | 9-85 | None |
| A0A3A0HR25 | 9-91 | None |
| A0A495N3E0 | 39-127 | None |
| A0A1H4ATU4 | 42-148 | None |
| H6LHH2 | 25-134 | None |
| A0A410QFX2 | 51-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.