DPCstruct | MC45536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 9.35 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 51.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8SMV8 | 20-115 | YFVGVSSAQEVFEPDCCSFQGSFQKLDLRTGEVLWRTSMLPEGSGFTGAAVWGSSPPIEKRRRLIYIATGNLYTAPREVEECEAARA… |
| A0A383VAH7 | 513-589 | ATYPCCTFIGSMLKVDLAGNILWRTLMAPDNNGQTGAFSGNSVWGSSPAVDVARNQVYIATGNNYEIPDDLADCIKA |
| A0A6A2ZUS6 | 302-399 | None |
| A0A835SLL2 | 142-235 | None |
| A0A5C7HQ41 | 190-293 | None |
| A0A498HD21 | 235-321 | None |
| A0A445AN13 | 373-476 | None |
| A0A4S4DGB0 | 361-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.