DPCstruct | MC4553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 87 ± 7 aa |
| Standard deviation of domain lengths | 7.02 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A254UUG4 | 1-81 | MRRPRLLIRAARFGLSDYSRKRDLKRVMRMSELPRPGAALRALMAEEMALDQARRAGEATYSVARHLELLIALLAEARLAR |
| A0A1M7TX94 | 22-125 | GAEPAPTPRIPPAHALRGLRRPRILARAARAAAAGYARKRDLPRLLPGFSPRDPSELMGKLRQVEAECEKARRAKATGYCAVRHVGI… |
| A0A2T0WTS2 | 8-88 | None |
| A0A132BVY0 | 13-98 | None |
| A0A5B8BYT1 | 1-87 | None |
| A0A1G6XCI9 | 20-109 | None |
| A0A0F9UC43 | 2-78 | None |
| A0A842I5Y2 | 25-100 | None |
| A0A3M0MP00 | 2-99 | None |
| A0A1H3A984 | 84-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.