DPCstruct | MC45525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 5.22 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0183 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9X4L2 | 1-80 | MVEDITERKRAEEALHENQSALAKAQQIAHLGNWRLNVETNQITCSDEVYRIFGVNSAEFQPTLEAFFECFHPDDVEFAR |
| A0A2V9S960 | 44-122 | AVTDITDRKRAEEALRRSEGYLAEAQRLTQSGSWAWNVRTGARFWSQETFRIFGCDPERVKPTWSDILERVHPEDRPAV |
| A0A244BZC8 | 1-87 | None |
| A6TT69 | 257-333 | None |
| A0A327X686 | 113-189 | None |
| A0A212DSG9 | 186-265 | None |
| A0A2N6CAJ8 | 21-95 | None |
| I5B5N3 | 2-81 | None |
| A0A7V3LHG9 | 186-259 | None |
| A0A1H3CR89 | 245-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.