DPCstruct | MC45520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 84 ± 6 aa |
| Standard deviation of domain lengths | 6.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 70.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5ZV62 | 78-152 | VSIPVMAKARIGHFAEAQVLQSLGVDYIDESEVLTPADYANHIDKWAFTVPFVCGATNLGEALRRITEGAAMIRS |
| A0A855XLR5 | 6-87 | ARVKRGAKARIGHYVEAKVLESLKVDYLDESVVLTPSDEVFHIDKHEFTVPFVSGAKDLGEALRQIGEWASMIRTHSKLAPS |
| A0A1I8HAI7 | 480-549 | None |
| A0A1Q9D7X5 | 330-415 | None |
| A0A834Z3B3 | 78-162 | None |
| A0A484MVF9 | 687-771 | None |
| A0A3F2S0I3 | 962-1036 | None |
| A0A5A7R3Q5 | 736-820 | None |
| A0A2H9TPY4 | 7-93 | None |
| A0A094HKH9 | 67-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.