DPCstruct | MC4552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 151 ± 17 aa |
| Standard deviation of domain lengths | 17.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06496 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S3UMC3 | 7-159 | LALVIGVMGGIATWAAVTLGSPFVLIWAIFVGWGSFFHCGGGTEGAKSSIAANIWGAVMAVVAFIALTTLGVTAVNAGICVGVTVLI… |
| A0A5N8UJE6 | 1-158 | MENRWQVAISAGLLAAVWAGVADSFSLVTWIGFLACSTYFAQPKPGFQGVLMSWATNLSGVFWAWIVISGSGYFESAFVGYLLTGIV… |
| A0A0M2T1W5 | 2-142 | None |
| A0A4T3EY53 | 132-294 | None |
| A0A2N5XRV5 | 54-227 | None |
| A0A1Q7E113 | 2-136 | None |
| A0A7K0D0J3 | 7-183 | None |
| A0A7W3DZA5 | 1-147 | None |
| A0A2S1JSR2 | 9-164 | None |
| F2JIW4 | 9-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.