DPCstruct | MC45515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 6.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 56.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HK89 | 1-93 | MAALFLQVNSWVAPVFEQTEDGIRAEDCTQPHKIGLEDHIPGQIRDWNEELQTTHELPRETLGERLIRERAIFKIHNDFVSAAIKVI… |
| Q7PZD5 | 357-443 | QVYTWTAPALEHTIDAIRAEDTFSSKLGYEEHIPGQTRDWNEELQTTRELPRATLPERLLRERAIFKVHSDFVTAATRGAMAVIDGN |
| A0A453PF06 | 248-349 | None |
| A0A6V7YBR4 | 361-443 | None |
| A0A4Z2CTG6 | 310-390 | None |
| A0A1B0D8T6 | 194-284 | None |
| A0A2H1BU70 | 151-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.