DPCstruct | MC45509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 96 ± 6 aa |
| Standard deviation of domain lengths | 6.30 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 51.38 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | CL0186- CL0476 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7Y3F9 | 1-92 | MGPRWKGKGAEVKALADPISEIVIQLQSSLICSNSRGLLSDTNVLLKADTEQTELLNRACFGRPRVTAEKNEQWFQLCMEEAFYLQY… |
| A0A4Y7K348 | 21-116 | MEPRWKGKNAETKALADPMSKIVERLQSSLRKSDAQGLLLDSVVLLPVDHEQIEVIELLNRSFFGRPRPNSYEHKQWYELDFEEAFY… |
| A0A4D9ACM4 | 1-92 | None |
| A0A0D6R9W3 | 4-115 | None |
| A0A0D9XTW5 | 335-443 | None |
| A0A803PWJ8 | 248-338 | None |
| A0A817B9I5 | 1-93 | None |
| A0A1U7YTF9 | 1-93 | None |
| A0A830CGA6 | 1-92 | None |
| A0A1R3HLH7 | 213-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.