DPCstruct | MC45508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 7.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7XYY5 | 1-77 | MIGPHWSEEDLTHFYQAYRKYGKDWEKVAAAVKPRTAEMVEALYIMHMAYLSLPEGTASAVGLIALMTDHYCYLVWL |
| A0A6P8E6M8 | 22-108 | TRRRQPGGLVCLLGSKWSEDELVHFYEAYRKFGKDWVKVAAAVGHGRTKEMVETLHSMNETYLSLPEGEEAATLGGFISHMTDRYDY |
| M4BIL5 | 3-95 | None |
| A0A1S3ZB19 | 1-86 | None |
| A0A0D9X542 | 10-97 | None |
| D0MSC2 | 4-92 | None |
| A0A6S7NHF2 | 228-305 | None |
| A0A3R7GQM0 | 4-94 | None |
| A0A816MQJ5 | 27-114 | None |
| A0A438F6U7 | 21-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.