DPCstruct | MC45503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 164 ± 22 aa |
| Standard deviation of domain lengths | 22.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.41 |
| Pfam Score | 91.05 |
| Assigned Pfam label(s) | PF01584- CL0063- PF03705 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6CB37 | 39-192 | LPEPGTALETIFALLKSTAGFDFTQYKPATLNRRMQRRMLLYKLESLEAYAQYLLEHPAEVKALYEEILIHVTSFFRDLEVFQHLKE… |
| A0A3M2AR65 | 4-175 | IVMSQETFNRLRELIYTRSGLEFPESKKYLLESRLRSRLAAVHCRTFEEYYHFLRFDPQREQEFTELFNCITTNETFFFRDMAQLDC… |
| A0A534C2H0 | 434-606 | None |
| C5T1Y7 | 37-201 | None |
| A0A7W0Q536 | 224-393 | None |
| A0A171K0V4 | 11-138 | None |
| A0A5C6X4I8 | 20-196 | None |
| A0A2N9L9Q0 | 5-129 | None |
| A0A4R5Q906 | 5-174 | None |
| A0A2D4RYA6 | 32-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.