DPCstruct | MC45502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 167 ± 28 aa |
| Standard deviation of domain lengths | 28.15 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21813 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381E8K7 | 16-195 | YLALRDDMLAAALPYLGLAQERQKQLQRWANDSKYLSDVDRSAATALLGKHPCRLQYIGRSENNRWRWAWDDPADYYPPEALRDALR… |
| A0A366IEW5 | 5-187 | LQDLVNSAVFLSTEMQSHFGRLIADASWDVDFTADPQLTFSSEDGTLRTRPHLLGSESHGTWLWGWENINDFPEPVVAVSHRVRRFG… |
| A0A809QGL3 | 25-175 | None |
| J4VAP5 | 2-175 | None |
| A0A7X6RJF7 | 766-943 | None |
| A0A3P3VX90 | 6-190 | None |
| A0A3M1TLH8 | 3-216 | None |
| A0A3M1CYV7 | 11-132 | None |
| A0A7U2KH43 | 37-181 | None |
| A0A842J2Z7 | 12-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.