DPCstruct | MC45500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 638 |
|---|---|
| Mean domain length (aa) | 116 ± 22 aa |
| Standard deviation of domain lengths | 22.33 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 72.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.00 |
| Pfam Score | 99.00 |
| Assigned Pfam label(s) | CL0123- PF05485- CL0361- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8VEW0 | 56-167 | TLPDFCAAYGCSNRRSLQTITRGITFHVFPKTEERRRQWEVALRRDGFVSSGRTLLCSEHFRSEDFDRTGQTVRLKDGFVPTVFNFP… |
| A0A0L0CPP1 | 3-87 | GCRCYFRDCHTNNPKYSRLHFFRFPIKDVERFKKWRQYAKTENMMEFSEMRRKNMNICARHFRAEHFMNYRMDRLTPNAIPTLMR |
| A0A1Y1N6B5 | 1-106 | None |
| A0A3Q0IPZ2 | 72-169 | None |
| A0A3Q0IYL6 | 166-307 | None |
| A0A7M5WQG4 | 24-153 | None |
| A0A7M5X5S6 | 3-131 | None |
| E9FUT2 | 105-221 | None |
| A0A2B4S595 | 2-153 | None |
| A0A2B4SCC7 | 6-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.