DPCstruct | MC45496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 147 ± 14 aa |
| Standard deviation of domain lengths | 13.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9XP83 | 21-178 | NNRKLGDAVFGVKLRLPVDQYQKTMRTSKYSLLIIMLTFISLFLTEVIRKQRIHIFNYILIGVAMIIYYSLLLSFSEQIGYNKAYLV… |
| A0A2G6GW90 | 293-435 | ETRNLYGLVERAVKYGILLIVFTFLTFFFTDQFTNTNIPIVGYLLVGLALILFYTLLLSIAEYLSFGPAFLISALAITIQISVYLYG… |
| A0A2G8TD96 | 812-954 | None |
| A0A377R4K8 | 28-180 | None |
| A0A0T5ZB06 | 47-162 | None |
| A0A7J0ARW2 | 3-137 | None |
| A0A7C7C1W4 | 85-230 | None |
| A0A378QTQ1 | 318-468 | None |
| A0A7Y4T2Z3 | 114-263 | None |
| A0A2N1RMD1 | 226-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.