DPCstruct | MC45494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 131 ± 20 aa |
| Standard deviation of domain lengths | 19.64 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M5PZ89 | 12-139 | NFTQINGGIFLLLLAIFLLYSFSIYCGYLLIKKRNIKGLNLSVYNQLIQIIGFGVLGYAFHFTAGIYGGIKLNLTNDTIATFMFGHS… |
| A0A2T5HGB7 | 11-150 | SRALAVLLVSGGLLGISTGVILGLQLLAVSLLMILPVSMLLAVNLWAVVAGIALWRGTARGWKWGSICYAMQIPILAIHGASYEFFT… |
| A0A3D2C3C2 | 3-112 | None |
| A0A833D6G1 | 1-137 | None |
| A0A2E7UPS4 | 63-185 | None |
| A0A3T1D8C3 | 25-125 | None |
| A0A6G3ZRY8 | 83-211 | None |
| A0A4R7E893 | 2-171 | None |
| A0A2D5RG38 | 2-94 | None |
| A0A7D4AW33 | 33-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.