DPCstruct | MC45490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Standard deviation of domain lengths | 10.14 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U1A4E3 | 23-93 | NDGFPVPSRAQAFVRGIIEKIYKKRVAEQIRILYGGSVKPTNVDELMVQPDIDGALVGGASLIAASFGRII |
| T0TNK2 | 2-64 | CKVVRDVVAADFGQEVADKVRVQYGGSVKPENVAEYMACPDVDGALVGGASLQADSFLALLDF |
| A0A1Q3DDY8 | 374-472 | None |
| R7JJV8 | 280-366 | None |
| A0A4S8ISP0 | 44-125 | None |
| F3KBR0 | 2-64 | None |
| A0A2A2K2M1 | 6-76 | None |
| A0A0D3DTC3 | 66-144 | None |
| A0A1Z5ST57 | 556-648 | None |
| A0A7S2V0N5 | 93-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.