DPCstruct | MC45487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 100 ± 14 aa |
| Standard deviation of domain lengths | 14.28 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.84 |
| Pfam Score | 52.38 |
| Assigned Pfam label(s) | PF07252- PF07006 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7CA38 | 2-90 | QKHEEKKQDQAIVDEYKPIVEDFVKANFEGVNSVEFKGWKNNPMDTIYLSGYVNGKESYLFDAPLHKDKDGNYDSGGMVVSKELNSL… |
| A0A2N6SEW1 | 8-119 | TITSILLLIGIVAGSIYYEKYKIEHIVKSDKAKTAIENMLKKMENKALTPEGKIKSYKIDYNKVEKNPMGGINISVIVNDNEEMIVN… |
| A0A7U8SP96 | 2-103 | None |
| S6G2Q9 | 1-85 | None |
| T0TRG4 | 12-123 | None |
| W7BKK8 | 1-104 | None |
| W5IJG2 | 6-145 | None |
| A0A3N9TMH6 | 124-217 | None |
| A0A7X0ZAD7 | 31-112 | None |
| C8NGB1 | 160-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.