DPCstruct | MC45486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Standard deviation of domain lengths | 9.29 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0245 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7C5Z2 | 3-72 | EKIAIVTDSTAYLPQAVIDKFEIYSVALSVTIDGKSYVENKDIDESNFYNIVKEAKFFSNNFSTGARRFC |
| X1N7H2 | 1-74 | MAIKVVTDSGADLPAQLAEELGITVVPLYVRFGEEVYRDRVDISEDEFYRRLLHDPVHPSTTQPTPQDFADVYQ |
| G6ENQ0 | 1-69 | None |
| T0DQQ1 | 1-73 | None |
| A0A417W0R3 | 54-124 | None |
| A0A6B1E3Y9 | 58-147 | None |
| A0A535KSW3 | 349-434 | None |
| A0A534Z4Q4 | 65-129 | None |
| A0A127SNC0 | 162-247 | None |
| A0A0R1T1C8 | 19-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.