DPCstruct | MC45485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 150 ± 31 aa |
| Standard deviation of domain lengths | 30.59 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7C3B7 | 44-203 | ASEQELPTRVVNVAPVEQDFPEGQFARLLKATATSSEKMTVPIAKSYALEGSSNKGYLDIRWQALTGAIGYKVGLFNGVTYDFIDVG… |
| A0A7W1YEM9 | 312-465 | TLPAKPGKSVIKTFSSGPGTGTGYMDISWQAVPGAIDYKVVIGNGYNYEYFNTGNVTSWSTKGKKIFPTQEEIDNKQYKFHQDGKGV… |
| W7CIU9 | 92-203 | None |
| A0A653VUR2 | 1-195 | None |
| W7BL34 | 56-198 | None |
| A0A842C4H3 | 392-515 | None |
| Q07833 | 623-747 | None |
| A0A1S7FV59 | 88-203 | None |
| A0A0M2NJ17 | 9-141 | None |
| W7CIR4 | 25-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.