DPCstruct | MC45484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 243 ± 38 aa |
| Standard deviation of domain lengths | 37.81 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.64 |
| Pfam Score | 46.43 |
| Assigned Pfam label(s) | PF18058- CL0598- PF18041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7BXH0 | 34-254 | LPDGDSKTALQKDLDRAQELLNQKTAAQAEQAKKDAADKAVKELFINDTPASDAIKDTTKQQTIDNAQKAIDLLADGPAKTAMQKDL… |
| W7BMT8 | 72-342 | AAEKARQEAAEASVKALFNNDNVNGTIKDATNQKAIDDARTLVNTVTDATKKAELENNLKEAQKQLDARNVVAAEKARQEAAEASVK… |
| A0A4P5PF86 | 13-236 | None |
| A0A7V6XJB2 | 69-276 | None |
| A0A2Z4ICK8 | 52-326 | None |
| D9SRP4 | 938-1133 | None |
| W7CFG3 | 267-503 | None |
| A0A559UIW0 | 13-202 | None |
| A0A5J6SJN7 | 120-414 | None |
| A0A1T4QL47 | 32-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.