DPCstruct | MC45480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 380 ± 33 aa |
| Standard deviation of domain lengths | 32.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14744- PF14746 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4HB68 | 211-589 | KMRHFADKVLQLSPIDDHLPNQIIDQGIDVLQIMRNIHTFASSYAYNMNLQIFVEMQSKSKHLDIIGTRHVANSVQTHGTGIINTTV… |
| A0A2D8AM95 | 1-413 | MEMRNLAIEKYSLRCAEIELPSQTLEQGLDVLELMRNIHIFVSKYNYNLNTQCFVEKASADSDRKHLNTISIRHVANSIRTHGTGIT… |
| A0A329R7Z2 | 1-344 | None |
| A0A817Z8E5 | 340-719 | None |
| A4I0W7 | 993-1436 | None |
| A0A834YD10 | 212-528 | None |
| A0A6U0K852 | 838-1214 | None |
| A0A1D1XXP7 | 433-825 | None |
| A0A6G0T1R9 | 121-500 | None |
| A0A5S6Q1S3 | 305-675 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.