DPCstruct | MC45476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 219 ± 35 aa |
| Standard deviation of domain lengths | 35.10 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.95 |
| Pfam Score | 77.37 |
| Assigned Pfam label(s) | PF00367- CL0166- CL0036- CL0493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377LV86 | 7-180 | ERTKAQAKAKYKAPMSDALRQLANVFIPLIPAFIASGLITGIINILKRPDIVGDFATHYPNLLGILGIFGSAVFAIMNILVGVNTAK… |
| A0A376FKP5 | 3-196 | RVRVEVHNDDQLDVPRLKQLSGVSGYVKQGQQHQLIVGPGKAAQVVDAMRALMGVSASASMDDAGAHQSAGKGQIQSPPMSDALRQL… |
| A0A430FKW7 | 7-207 | None |
| G1WL59 | 3-222 | None |
| B9DLG6 | 5-219 | None |
| A0A7X2MZX8 | 2-226 | None |
| A0A4R8A5E4 | 73-317 | None |
| A0A0R1QUC0 | 6-189 | None |
| A0A2X3IXP5 | 5-195 | None |
| A0A1H8FFC2 | 19-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.