DPCstruct | MC45474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 112 ± 3 aa |
| Standard deviation of domain lengths | 3.46 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 79.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376FI40 | 1-115 | MPRQNEEDAARFISLGLKRNQLAVTGSLKFDISVTPELAARAITLRRQWAPRRQVWIATSTHDGEEEIILQAHRKLLEKFPDLLLIL… |
| A0A5J4DU34 | 425-533 | FSRIEVVLAQNELLAQRFIQLGARRAVAVGNLKIDAPPPPYDNGELEQLRQCLKGRRIFVAASTHPGEDEVVAEAHQKLRADFGDLL… |
| A0A6L2NF32 | 1-115 | None |
| A0A3S4I0N6 | 90-199 | None |
| A0A6A4NRP3 | 48-152 | None |
| A0A287M0X5 | 120-232 | None |
| A0A4D8YPN6 | 123-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.