DPCstruct | MC45473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 93 ± 8 aa |
| Standard deviation of domain lengths | 7.62 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376FGA9 | 1-112 | MNDGEILAGIFLRLRKMYAEEGGANPEPVLNMTWNYSTPENPAPEEVAMESNGKALADVIDPATGTVLAKKGDQLSTFAHLRDDGTT… |
| A0A4V6KKF7 | 56-146 | AGLYHRLRQMYGSEGGKGVEPLLKMGWHYERPDHPESEEVAKDSNGYALEDLYDANGNLLAKKGQLLDSFAMLRDDGSTASACWIYT… |
| A0A853AIW8 | 15-95 | None |
| A0A485D191 | 6-97 | None |
| A0A3C1G9Z8 | 244-333 | None |
| A0A6P4I2Y6 | 369-459 | None |
| A0A5J4KVR5 | 405-496 | None |
| A0A1V3X8U6 | 443-543 | None |
| A0A447WA83 | 69-161 | None |
| A0A6P1ZB83 | 3-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.