DPCstruct | MC45471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 175 ± 27 aa |
| Standard deviation of domain lengths | 27.07 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0292 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376FFI5 | 24-179 | MFIDLFMHRHDKPVSLKSAAMWSIFWVMMAMAFAGFLYVHHGAEMASLFLTGYALEEVLSVDNLFVMMAIFAWFGVPDKYRHRVLYW… |
| A0A2U1C819 | 45-199 | SVLWFSLSFVFVGLLWWYLNDSQGREVANTVSMQFITGYLVEKSLSIDNIFVFLMIFSYFAVPEQYQKRALIIGIIGAIVLRAILIL… |
| F8KUW8 | 23-238 | None |
| A0A7R9TDF4 | 381-557 | None |
| A0A540K6J5 | 21-172 | None |
| A0A6V2K595 | 151-339 | None |
| A0A6G1EHX6 | 72-244 | None |
| A0A1X6PFB1 | 94-285 | None |
| A0A7S3ZKM7 | 7-210 | None |
| A0A0K9QW97 | 110-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.