DPCstruct | MC45468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 72 ± 3 aa |
| Standard deviation of domain lengths | 3.13 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 56.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00920 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6XDK9 | 1-75 | GPADINHFQAAGGVPVLMRELLKGGLLHEDVNTVAGFGLHRYTLEPWLNNGELDWREGASNSLDPQVIATFEQPF |
| A0A376FAR3 | 1-70 | MARLYPNGPADINHFQAAGGVPLLMRELLKGGLLHEDVNTVAGFGLKRYTQEPWLNNGELDWREGASASL |
| I5C840 | 4-77 | None |
| J0Z231 | 127-200 | None |
| A0A0A2VCR2 | 333-402 | None |
| A0A4Q3I270 | 226-298 | None |
| A0A2X3H9S6 | 29-100 | None |
| A0A2X3EF00 | 5-74 | None |
| A0A3C1NJD5 | 69-144 | None |
| A0A378AA27 | 200-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.