DPCstruct | MC45464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 185 ± 22 aa |
| Standard deviation of domain lengths | 21.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 30.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0IX11 | 5-175 | SAVYGRTADGLLAARIGDIACIAVPVCGGLRLATAWRLAKPLDQWRAGDALASEGIVADDMAFRAHVEDVAHHQRQLGRLSRQRLTT… |
| A0A7L8S534 | 1-204 | MNATAQTEATIDNTSGFPEVYYGRTSDGLFAALVGENAFAMIPAYNGGRYLGHAWKLPLPISEWKQSSFYGHGGQLDGKAAFRARVE… |
| A0A401X830 | 1-229 | None |
| B8HIC0 | 6-205 | None |
| A0A4U8Z7L9 | 139-309 | None |
| A0A8A3LP37 | 6-167 | None |
| A0A1U9LIJ2 | 72-270 | None |
| A0A4R3RST9 | 1-186 | None |
| A0A4R2TVZ3 | 1-156 | None |
| A0A7X8YB44 | 13-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.