DPCstruct | MC45451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 274 ± 19 aa |
| Standard deviation of domain lengths | 18.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3JAC8 | 1-297 | MVAARAPVDEALRSTARRLAGLGAAAPRAQQARQASHDRAVSESFARFEERNGQAMLRWSAEQLRPADGATVFYPFAGPDLVTARRF… |
| A0A2V2RNF7 | 45-303 | LPVDSQAPAGIPRQASVDEQAKFLAGIDLPNDSALAPLQSTATYRDHARQFAKAWSNFNLTHFSKMQAWSQSELQPKLPSASVLLYM… |
| V5SEM1 | 1-279 | None |
| A0A0C1BZR6 | 257-504 | None |
| A0A2T6DGJ9 | 50-321 | None |
| A0A2G6J2Q1 | 95-381 | None |
| F8L217 | 471-719 | None |
| A0A6N6SKU9 | 33-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.