DPCstruct | MC45449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 169 ± 17 aa |
| Standard deviation of domain lengths | 17.29 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2CVZ1 | 1-180 | MLRTDGLRETINRDLGPLETLWHVRAALNVAALSCTGPLYERLVDDYNAFISNNSASLRNANNAIIRKFQREVGAGYKTQHDIHQTQ… |
| A0A1D7NKK6 | 78-242 | MDIPGRGADGRWLTVNTALTDDQLVWNLRSAWNVAALNCLSPEYQPILDGYKAFLNRNVSSLKGVNDRLERSYNSRFKARRDAIVAR… |
| A0A558R4R7 | 2-156 | None |
| T0IZJ5 | 5-206 | None |
| A0A7X0JEN7 | 57-238 | None |
| Q2NCX9 | 31-206 | None |
| A0A501XD33 | 1-166 | None |
| A0A7W7B3Y7 | 41-195 | None |
| A0A552U7Z9 | 58-207 | None |
| A0A519QTW6 | 15-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.