DPCstruct | MC45448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 107 ± 9 aa |
| Standard deviation of domain lengths | 9.06 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.62 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | CL0396- CL0303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402FS78 | 1-88 | MANKSSVGVFSIIVFGSIINEGYVNSEKSPILRCVYNGHEGACNYGVAIGLIAFLACCFFLVVDLNFQQISSVKDRKRVVLLDLAFSG |
| A0A6Q2X9S3 | 1-112 | MEGMAYGAGKAGGAFDPTAFFQQPHTILRIISCLFSVVIFGCIANEGYVNRPDEVQEFCIFNRNQNACNYGVFMGSLAFLCCLAFLA… |
| T1HAC9 | 1-114 | None |
| A0A151P450 | 222-322 | None |
| A0A0B2VJ76 | 1-115 | None |
| A0A3Q3B366 | 19-117 | None |
| A0A3B5L4J4 | 1-87 | None |
| A0A1S3G396 | 14-119 | None |
| A0A2I2YTA5 | 1-113 | None |
| A0A6P6BS33 | 12-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.