DPCstruct | MC45446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 9.25 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2ZAA0 | 14-89 | LRWRPGKAEGEVESNARLVRWSDGSHSLQVGGTPYEMLTQDVKSFNYFAFARHGAGGGAGAGLLEGCGALEKRHTV |
| K7IGJ9 | 2-78 | ENTLRWRIRKDESGREVRESNAKIVKWDDGTMSLYLGNEIFEVTLMELNKNNLPHLYVQQPGLMSAQSVMTHRMTFR |
| A0A7J7FBZ9 | 2-81 | None |
| A0A7S0G448 | 2-93 | None |
| A0A7R8Z9E5 | 2-73 | None |
| A0A388JPW3 | 391-492 | None |
| A0A7R9JVK7 | 2-73 | None |
| A0A7S2EZP3 | 16-96 | None |
| A0A1Y5I600 | 9-83 | None |
| A0A367YKC1 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.