DPCstruct | MC4544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 235 ± 24 aa |
| Standard deviation of domain lengths | 24.44 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7ZFH6 | 131-348 | NDIKSRLEKEYQNISGINVDKKRVPMSMYKDYIAGLEREGINVVECPIPGGDIENPKDNWVWSVYSDEQLYLRTLKIYHEVIIGYKE… |
| A0A2W4W872 | 1-242 | MAEALSQIDEEVRQNIHWILPEIHSISNKEQDFCLDCLRQEIKLMQSNNVSDFSLSYTDVDLVYKTWRWDNDPAKIENLKKRVEEIY… |
| A0A410DSU0 | 298-520 | None |
| A0A7X8DAE8 | 718-984 | None |
| A0A1H4EL07 | 600-862 | None |
| A0A1N7NLQ0 | 769-1054 | None |
| A0A365URN1 | 1-211 | None |
| A0A7W7RFH3 | 707-918 | None |
| A0A7H8LHC8 | 352-581 | None |
| A0A0J1KDL7 | 239-455 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.