DPCstruct | MC45437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 9.94 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0048 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q4WNL6 | 1-101 | METSWIDLGPTSLTAHGRAAAAEPAPYWLDYRLDTGDGFTTRRMHVTARTPDTTRTLDLRRDETTGHWTVDGTPRPDLDGALDCDLG… |
| A0A3S4IFR9 | 3-101 | QMLFWQRLDCPGLEQAEIETGAGLSLSASGSLLHADTGASLRYRMQLDHHGRLSHAHIDLSAPDARQLTLQHAETGRWLVNGQPEPA… |
| A0A0M4L155 | 14-116 | None |
| A0A7Y5UGL0 | 6-105 | None |
| A0A0A8RR67 | 102-238 | None |
| A0A7V9VDZ7 | 4-107 | None |
| A0A2S5X9H4 | 91-208 | None |
| A0A2M9BWN8 | 3-92 | None |
| A0A345Y7K3 | 1-102 | None |
| A0A1V9GDG1 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.