DPCstruct | MC4543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 337 |
|---|---|
| Mean domain length (aa) | 140 ± 32 aa |
| Standard deviation of domain lengths | 32.08 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 88.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 20.17 |
| Pfam Score | 90.92 |
| Assigned Pfam label(s) | PF11307- PF03692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T5R3G9 | 20-192 | RVDSAIFSRRYFAHCMACGFCGDSCCQYGVDIDIENVGRIMDVADRLEPFAGSRRDQWFENGYEDDPYFPGGKVTRTQVKNGACVFL… |
| A0A832ZKF3 | 10-135 | GISWVCRRCGRCCDPPTITRKDIANICGYLKIPFKEFIRRYVGHFNGIMGELKGVKNRCIFLKNNRCSIYPVRPLICRLRPYSIQEI… |
| A0A7X7VH77 | 24-145 | None |
| A0A7V3ADR7 | 140-267 | None |
| A0A7V2UA15 | 21-181 | None |
| A0A538QRI7 | 144-339 | None |
| A0A7C1KVS9 | 10-150 | None |
| A0A356J0S2 | 11-168 | None |
| A0A1G3YKA9 | 9-136 | None |
| A0A533ULG8 | 62-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.