DPCstruct | MC45428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 186 ± 19 aa |
| Standard deviation of domain lengths | 19.07 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0BM06 | 5-198 | NWQCLEGINTPVSLTSDNNVQCMSTDATGCVWGNDATACRETVANPPQQVIKPLVCGDAHKNLYGITGYDTPSHWCSIAKSKLGVTP… |
| A0A1V9YFV1 | 71-229 | WQCLPNVETPVRRVASGDVECMSRDGFSCVYTPTFADCVRYQLTPVTPLQPLVCGAMLKSINRFTGYDIPAHWCARAQPLLSKQPWK… |
| A0A519EFY4 | 1-196 | None |
| A0A485KFR0 | 286-520 | None |
| A0A485KDD8 | 2-185 | None |
| A0A485K584 | 30-203 | None |
| A0A397A7C2 | 8-192 | None |
| A0A418AM42 | 4-205 | None |
| A0A519E537 | 1-205 | None |
| A0A067C695 | 1-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.