DPCstruct | MC45427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 131 |
|---|---|
| Mean domain length (aa) | 271 ± 53 aa |
| Standard deviation of domain lengths | 52.71 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.54 |
| Pfam Score | 99.58 |
| Assigned Pfam label(s) | CL0209- PF07059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V9YA20 | 178-464 | ASMITARQATATPVNFAPSRGSAKAGAETPDEDSEYWKTTFKALVPQHRSITANWREPSPIEFRVRSKKYLTDNVKEAVDRPKCDLV… |
| A0A2G3ANR4 | 8-232 | LRHDDSDNGRDCWTVSDGKNFRLRGKNFCSDKTKVTAGKSLMDLVAVDWFKDTKRMDHVARRPGCAAQVASEKGLFSLVINLQVPGS… |
| C1MLL2 | 176-434 | None |
| A0A7S2URM0 | 381-690 | None |
| A0A1Q9C8N6 | 86-494 | None |
| A0A5N6PSP5 | 94-394 | None |
| A0A7J6LNX2 | 259-541 | None |
| K0TKP2 | 246-564 | None |
| A0A7I4C0N4 | 251-551 | None |
| A0A388LA76 | 28-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.