DPCstruct | MC4542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 153 ± 16 aa |
| Standard deviation of domain lengths | 16.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 19.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4YQF2 | 22-175 | LDRRTRLKLMLGETGITASGGIAYENKGLDGVRNSDVVFCVFSKGVIYQPTEFTLAMADSEGIVYGHDVPKMMPRESIRDNGVWITD… |
| A0A1V4ZCI5 | 64-224 | LDDEFRREIYDTELKAEENGCIGGLMPFVNRGVFETLERDHCFIIVVNESMLLLSQSRDVVFISDEKGQKLGEYLPPNHRDDVRNKP… |
| A0A6B9T8A2 | 2-130 | None |
| A0A7Z8KNP2 | 25-186 | None |
| A0A328S0L7 | 7-146 | None |
| A0A0E3SRE8 | 2-145 | None |
| A0A1V4YD41 | 16-207 | None |
| A0A7W0HJS3 | 592-759 | None |
| A0A126QV81 | 23-174 | None |
| A0A843J4G8 | 2-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.