DPCstruct | MC4541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 264 ± 21 aa |
| Standard deviation of domain lengths | 21.38 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5Q0EGR4 | 255-498 | VAVAFDRIDSAAKAAHVMAFLRKKAQEFFYALVTDDAGKILSLQLHTKGGRDFSAVPYEVVGPAIAAVEGGTKVWFGHNHPSGNMAP… |
| A0A0G2BJB5 | 1-300 | MQHENPLSVPLYRVIATQGQCSIKGADPIEDLASRVRVLRDLLRGNPGQLAAVILRKGKDKGLRPFGSISMGTTQAPQTATAIKAAL… |
| A0A7M1T407 | 28-306 | None |
| A0A2B8J9D5 | 11-238 | None |
| A0A1Z3CJH9 | 516-798 | None |
| A0A7Y9FTV6 | 138-399 | None |
| A0A2X1UVR0 | 47-332 | None |
| A0A1U7PY09 | 170-434 | None |
| A0A0R2GS31 | 18-297 | None |
| A0A2U3K751 | 278-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.