DPCstruct | MC45404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1695 |
|---|---|
| Mean domain length (aa) | 103 ± 16 aa |
| Standard deviation of domain lengths | 16.35 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.15 |
| Pfam Score | 90.30 |
| Assigned Pfam label(s) | CL0126- PF18265- PF13879- CL0304- CL0466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E4ZX87 | 9-102 | SKTSYLGASIEFNEDDMAVISEYTKKGTPAYNAGLEKGDIIIAINNQSFSDIDQFNAALQKHKPGKKVTIMYKRLNVENKVLVKIAP… |
| A0A2H6ABF1 | 125-212 | WVYPLPENIGLVLEIDAGNRVQRVLPRSPAEQAGLQAGDILVRIHGVPIRSQADCMYALHLAPQQGELTLQFQRGQQLRKAVLCLPYG |
| A0A7M5US00 | 201-328 | None |
| A0A7X7ZIV5 | 386-475 | None |
| A0A168B0M6 | 457-553 | None |
| A0A518HRC8 | 260-343 | None |
| A0A349MIK2 | 71-183 | None |
| A0A165A5R5 | 411-541 | None |
| A0A139QLU9 | 33-124 | None |
| A0A837PZJ4 | 55-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.