DPCstruct | MC4540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 117 ± 6 aa |
| Standard deviation of domain lengths | 5.71 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9CLW3 | 1-113 | VVDDVARQYSGALRNSCQSHGGSWEFLDRLVDRLRTYDTRWGYNGKRGNASDPSHDIVAYNFGAGPDNGTTNVYIIDVIVGHCGSNP… |
| A0A0G2AVK9 | 638-753 | APLPNRLDIVQQVASDFPNYLANSCQDQGGTWEFMDEVVGRLHAQDERWGYLGQRGNVNDLAQDAITYYYGSGSPTTGSREVYGIDI… |
| A0A7V9CNB7 | 70-179 | None |
| A0A6A7L121 | 176-286 | None |
| A0A521U8U8 | 259-376 | None |
| A0A1F9YWY2 | 1-117 | None |
| A0A3N5GA68 | 2-118 | None |
| A0A7W0K6L2 | 53-181 | None |
| A0A7R7Y6E0 | 606-731 | None |
| A0A7W0K6T4 | 231-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.