DPCstruct | MC454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 122 ± 12 aa |
| Standard deviation of domain lengths | 11.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 66.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.89 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5EAA4 | 1-97 | MSEDNELEKRAVEELLKETDRARVRAETMGPAGWLKCPLQSTNKRFLLNTLRSTGLQRRPSESRDRHPPTRGRRSSESPDRSRDRSR… |
| A0A6J3EPX3 | 5-126 | EEDPELERKAVEELLKEAKRGRTRAETMGAMGWLKCPLAGANKRFLINTIKNTLPSQKEQDQEREQREVSKEPEPNKSRKEEKPKKR… |
| A0A401SAH7 | 65-191 | None |
| A0A674ICQ5 | 69-184 | None |
| A0A7J8DZ07 | 22-145 | None |
| A0A6J0YY85 | 2-118 | None |
| A0A5A9N6I3 | 3-141 | None |
| A0A2D0PV34 | 23-138 | None |
| A0A6S7G0F0 | 7-145 | None |
| A0A835NUG5 | 40-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.