DPCstruct | MC45398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 70 ± 13 aa |
| Standard deviation of domain lengths | 13.34 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08906 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N9R7R8 | 17-88 | QSKEKRFLDQKDYKNKPLFDRAVKKYGELNKNEMFGFEPALILGGAVKLENIRKLPIISHLQFLASLDTPRM |
| A0A7M3FU80 | 110-161 | EALKQYNELDYEECFGYTPLLGLGGAEKVENLKKVKLKEHILIITSFMGPVQ |
| A0A3E2YF61 | 39-123 | None |
| A0A653X8S1 | 288-347 | None |
| A0A077N0K9 | 4-78 | None |
| A0A2T1IB64 | 60-133 | None |
| A0A0B5KJ17 | 2-60 | None |
| S7WEM8 | 22-102 | None |
| A0A2V5CLI1 | 36-101 | None |
| A0A1S1LY19 | 2-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.