DPCstruct | MC45395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 135 ± 11 aa |
| Standard deviation of domain lengths | 11.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I2YQB5 | 1-135 | MTTNRQVQKNLADLRSRIIRGEIGKTILWQGADVVILAELPGESEPGFYPDPLFVRSDFAEELSWLFYELKAAFDDQIDFENKFYFY… |
| A0A418PRI7 | 2-113 | KEQLQTLREKINSGQFPTHFPHFGGANLIITDNPNRSFHEGDVVIYTAHASAMSWLVMELKEIYGGHLNSLSKYRFYPEIGKLIQES… |
| A0A7V0YGX7 | 1-147 | None |
| A0A7I7PKQ4 | 193-332 | None |
| A0A2T1E009 | 7-148 | None |
| I5C8F0 | 1-124 | None |
| A0A7X7I480 | 153-298 | None |
| A0A419GLS7 | 14-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.