DPCstruct | MC45391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4995 |
|---|---|
| Mean domain length (aa) | 205 ± 47 aa |
| Standard deviation of domain lengths | 47.12 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.35 |
| Mean intra-cluster sequence similarity (%) | 11.89 |
| Pfam Score | 96.24 |
| Assigned Pfam label(s) | CL0213- CL0077- CL0015- CL0219- PF17811 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6DT82 | 10-207 | NYAILDNFIDPEEGRLLRNEIQQLYRDGRMVDGKIGKNAAGTDGDVRPDMRTDKMVWMEGSEPFVGKYLKRHILRADILAQKINLLL… |
| A0A0E0EIQ9 | 53-166 | TPKKTNKVGSNITLINVMQIPGLNTLGISIARIDYAPLGQNPPHTHPRATEILTVLEGTLYVGFVTSNPNNTLFSKVLRKGDVFVFP… |
| K8EYE3 | 209-460 | None |
| A0A2R7RYA0 | 6-173 | None |
| A0A7S1XMZ7 | 30-205 | None |
| K8FD04 | 126-395 | None |
| K8F765 | 76-293 | None |
| A0A4V5N717 | 313-496 | None |
| K8EB96 | 126-287 | None |
| K8EJP5 | 57-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.