DPCstruct | MC4539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 146 ± 14 aa |
| Standard deviation of domain lengths | 14.25 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1HGB7 | 2-123 | AFLEAAVVVYLRELYYPEGFSFPLKMIPMKIYAVELGREAATIIMLAAIGWLSAKSFLNRFASFAIAFGVWDIFYYLFLKITLNWPS… |
| A0A0G1YR55 | 16-162 | RETSRNRTITILAIYAVAMGLLEAAVVVYLRELYYPQGFSIQSVWDLAVIPQKIMAVEYSREAATIVMLAAVALLAFRETSRRLWAF… |
| A0A2H0UYG3 | 10-173 | None |
| A0A1M3F6A3 | 5-165 | None |
| A0A3N5PUE5 | 6-152 | None |
| A0A496TYJ3 | 21-164 | None |
| A0A538T840 | 3-138 | None |
| A0A3D3HIU3 | 6-142 | None |
| A0A1F5VN51 | 27-185 | None |
| A0A1V5K896 | 16-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.